![]() |
Plant Transcription
Factor Database
v4.0
Previous version:
v3.0
|
Home BLAST Prediction RegMap ATRM Download Help About Links |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_3DL_DF0D3F3FE.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 90aa MW: 10364.5 Da PI: 8.6356 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 97.1 | 1.2e-30 | 5 | 63 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYG+K+vk+s++pr+YYrC+++gC vkk+ver+++d ++v+++Yeg Hnh Traes_3DL_DF0D3F3FE.1 5 LDDGYKWRKYGKKSVKNSPNPRNYYRCSTEGCYVKKRVERDKDDANYVVTMYEGVHNHA 63 59********************************************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50811 | 30.251 | 1 | 65 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 4.1E-30 | 2 | 65 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.09E-27 | 3 | 65 | IPR003657 | WRKY domain |
SMART | SM00774 | 5.7E-33 | 5 | 64 | IPR003657 | WRKY domain |
Pfam | PF03106 | 5.8E-24 | 6 | 62 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 90 aa Download sequence Send to blast |
EEEILDDGYK WRKYGKKSVK NSPNPRNYYR CSTEGCYVKK RVERDKDDAN YVVTMYEGVH 60 NHASPGTVYY AAQDPASGRF FVTGTHHLAP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2ayd_A | 4e-23 | 3 | 65 | 12 | 74 | WRKY transcription factor 1 |
Search in ModeBase |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG670306 | 9e-90 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004969741.1 | 2e-53 | PREDICTED: probable WRKY transcription factor 57 | ||||
Swissprot | Q93WU9 | 2e-33 | WRK51_ARATH; Probable WRKY transcription factor 51 | ||||
TrEMBL | W5DEA0 | 5e-63 | W5DEA0_WHEAT; Uncharacterized protein | ||||
STRING | Si004464m | 6e-53 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP441 | 37 | 206 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64810.1 | 1e-34 | WRKY DNA-binding protein 51 |
Publications ? help Back to Top | |||
---|---|---|---|
|