PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3DL_DF0D3F3FE.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 90aa    MW: 10364.5 Da    PI: 8.6356
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3DL_DF0D3F3FE.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY97.11.2e-30563159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY  1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                           ldDgy+WrKYG+K+vk+s++pr+YYrC+++gC vkk+ver+++d ++v+++Yeg Hnh 
  Traes_3DL_DF0D3F3FE.1  5 LDDGYKWRKYGKKSVKNSPNPRNYYRCSTEGCYVKKRVERDKDDANYVVTMYEGVHNHA 63
                           59********************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081130.251165IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.1E-30265IPR003657WRKY domain
SuperFamilySSF1182902.09E-27365IPR003657WRKY domain
SMARTSM007745.7E-33564IPR003657WRKY domain
PfamPF031065.8E-24662IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 90 aa     Download sequence    Send to blast
EEEILDDGYK WRKYGKKSVK NSPNPRNYYR CSTEGCYVKK RVERDKDDAN YVVTMYEGVH  60
NHASPGTVYY AAQDPASGRF FVTGTHHLAP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A4e-233651274WRKY transcription factor 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703069e-90HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969741.12e-53PREDICTED: probable WRKY transcription factor 57
SwissprotQ93WU92e-33WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBLW5DEA05e-63W5DEA0_WHEAT; Uncharacterized protein
STRINGSi004464m6e-53(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44137206
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.11e-34WRKY DNA-binding protein 51
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]